HBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10491

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HBP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HBP1 (NP_036389). Peptide sequence MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HBP1 Antibody - BSA Free

Western Blot: HBP1 Antibody [NBP3-10491]

Western Blot: HBP1 Antibody [NBP3-10491]

Western Blot: HBP1 Antibody [NBP3-10491] - Western blot analysis using NBP3-10491 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for HBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HBP1

The HMG-box protein-1 (HBP1) is a member of the HMG family of transcription factors, which are characterized by the presence of a conserved protein motif, the high mobility group (HMG) 1 box, that mediates DNA binding. HBP1 binds to the tumor suppressor proteins Rb and p130 and initiates cell cycle arrest. Terminal cell differentiation requires this initial cell cycle arrest followed by the coordinated expression of genes defined as tissue-specifc markers. Along with initiating the commitment to cell differentiation, the continued activity of HBP1 abrogates the expression of tissue-specific genes by associating with the MyoD proteins. In muscle cell differentiation, the MyoD family of transcription factors, which include Myf5, MyoD and myogenein, induce the expression of these cell-type specific proteins and contribute to the development of cell phenotypes. The progression of terminal differentiation is, therefore, dependent on both a decrease in HBP1 activity and the corresponding activation of MyoD-induced gene transcription.

Alternate Names

FLJ16340, High mobility group box transcription factor 1, HMG box transcription factor 1, HMG box-containing protein 1, HMG-box containing protein 1, HMG-box transcription factor 1, USMCC2

Gene Symbol

HBP1

Additional HBP1 Products

Product Documents for HBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HBP1 Antibody - BSA Free and earn rewards!

Have you used HBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies