HDC2/PHC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79447

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HDC2/PHC2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PHC2. Peptide sequence GGSGRPTGPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HDC2/PHC2 Antibody - BSA Free

Western Blot: HDC2/PHC2 Antibody [NBP1-79447]

Western Blot: HDC2/PHC2 Antibody [NBP1-79447]

Western Blot: HDC2/PHC2 Antibody [NBP1-79447] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Applications for HDC2/PHC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HDC2/PHC2

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

early development regulator 2 (homolog of polyhomeotic 2), Early development regulatory protein 2, EDR2, hPH2, MGC163502, PH2, polyhomeotic 2, polyhomeotic homolog 2 (Drosophila), polyhomeotic-like 2, polyhomeotic-like 2 (Drosophila), polyhomeotic-like protein 2

Gene Symbol

PHC2

UniProt

NP_932157 (Human)

Additional HDC2/PHC2 Products

Product Documents for HDC2/PHC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HDC2/PHC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HDC2/PHC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HDC2/PHC2 Antibody - BSA Free and earn rewards!

Have you used HDC2/PHC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies