HDHD1A Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-09989
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence FFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPN
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for HDHD1A Antibody - BSA Free
Western Blot: HDHD1A Antibody [NBP3-09989]
Western Blot: HDHD1A Antibody [NBP3-09989] - Western blot analysis of HDHD1A in Stomach Tumor lysates. Antibody dilution at 1ug/mlApplications for HDHD1A Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HDHD1A
Alternate Names
DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1
Gene Symbol
PUDP
Additional HDHD1A Products
Product Documents for HDHD1A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HDHD1A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for HDHD1A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HDHD1A Antibody - BSA Free and earn rewards!
Have you used HDHD1A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...