HERV Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60024

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ERVWE1(endogenous retroviral family W, env(C7), member 1 (syncytin)) The peptide sequence was selected from the N terminal of ERVWE1. Peptide sequence TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HERV Antibody - BSA Free

Western Blot: HERV Antibody [NBP1-60024]

Western Blot: HERV Antibody [NBP1-60024]

Western Blot: HERV Antibody [NBP1-60024] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for HERV Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HERV

ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The product of this gene, syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

endogenous retroviral family W, env(C7), member 1, ENV, envelope glycoprotein, Envelope polyprotein gPr73, enverin, ENVW, env-W, HERV7Q, HERV-7q, HERV-7q Envelope protein, HERV-tryptophan envelope protein, HERV-W, HERV-W Env glycoprotein, HERV-W envelope protein, HERV-W_7q21.2 provirus ancestral Env polyprotein, HERV-W{7q21.1} provirus ancestral Env polyprotein, HERVWENV, HERV-W-ENV, HERVWenvelope protein, human endogenous retrovirus W envC7-1 envelope protein, Syncytin, syncytin A, Syncytin-1

Gene Symbol

ERVW-1

UniProt

Additional HERV Products

Product Documents for HERV Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HERV Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HERV Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HERV Antibody - BSA Free and earn rewards!

Have you used HERV Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...