HINFP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85045

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HINFP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HINFP. Peptide sequence: FKDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HINFP Antibody - BSA Free

Western Blot: HINFP Antibody [NBP2-85045]

Western Blot: HINFP Antibody [NBP2-85045]

Western Blot: HINFP Antibody [NBP2-85045] - WB Suggested Anti-MIZF Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Transfected 293T
Western Blot: HINFP Antibody [NBP2-85045]

Western Blot: HINFP Antibody [NBP2-85045]

Western Blot: HINFP Antibody [NBP2-85045] - Host: Rabbit. Target Name: CHAD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Applications for HINFP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HINFP

MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase(HDAC) complex, and plays a role in DNA methylation and transcription repression.(supplied by OMIM)

Alternate Names

HiNF-PDKFZP434F162, histone H4 gene-specific protein HiNF-P, histone H4 transcription factor, Histone nuclear factor P, MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein, MBD2-interacting zinc finger 1, MBD2-interacting zinc finger protein, Methyl-CpG-binding protein 2-interacting zinc finger protein, MIZFDKFZp434F162, ZNF743MBD2-interacting zinc finger

Gene Symbol

HINFP

Additional HINFP Products

Product Documents for HINFP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HINFP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HINFP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HINFP Antibody - BSA Free and earn rewards!

Have you used HINFP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies