HMGN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84069

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HMGN2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of HMGN2. Peptide sequence: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HMGN2 Antibody - BSA Free

Western Blot: HMGN2 Antibody [NBP2-84069]

Western Blot: HMGN2 Antibody [NBP2-84069]

Western Blot: HMGN2 Antibody [NBP2-84069] - WB Suggested Anti-Hmgn2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

Applications for HMGN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMGN2

HMG17 (high mobility group transcription factor 17) is an 18 kD high mobility group chromosomal protein. This nuclear protein is common to all eukaryotes and is developmentally regulated. HMG17 binds DNA in a non-sequence specific manner and interacts with nucleosomes to modulate chromatin structure. HMG17 regulates the gene expression of p53, Hox transcription factors, and steroid hormone receptors (increases DNA binding affinity). Phosphorylation of HMG17 may interfere with nuclear localization and favor release from nuclei. HMG17 is upregulated by wild-type p53 and increases during embryogenesis and is downregulated during differentiation and development. This protein is modified by phosphorylation and acetylation. HMG17 interacts with nucleosomes and probably forms multi-unit complexes with unrelated proteins. The Poly6081 antibody recognizes human and mouse HMG17 and has been shown to be useful for Western blotting.

Alternate Names

High mobility group nucleosome-binding domain-containing protein 2, high-mobility group (nonhistone chromosomal) protein 17, high-mobility group nucleosomal binding domain 2, HMG17high mobility group protein N2, MGC5629, MGC88718, non-histone chromosomal protein HMG-17, nonhistone chromosomal protein HMG-17

Gene Symbol

HMGN2

Additional HMGN2 Products

Product Documents for HMGN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMGN2 Antibody - BSA Free and earn rewards!

Have you used HMGN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies