HOXA9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09930

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA9. Peptide sequence LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HOXA9 Antibody - BSA Free

Western Blot: HOXA9 Antibody [NBP3-09930]

Western Blot: HOXA9 Antibody [NBP3-09930]

Western Blot: HOXA9 Antibody [NBP3-09930] - Western blot analysis of HOXA9 in Jurkat Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for HOXA9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA9

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters namedA, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated duringembryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcriptionfactor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to theabdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and theNUP98 gene has been associated with myeloid leukemogenesis. (provided by RefSeq)

Alternate Names

ABD-B, homeo box A9, homeobox A9, Homeobox protein Hox-1G, homeobox protein HOXA9, homeobox protein Hox-A9, homeodomain protein HOXA9, HOX1, HOX1.7, HOX1GMGC1934

Gene Symbol

HOXA9

Additional HOXA9 Products

Product Documents for HOXA9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXA9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA9 Antibody - BSA Free and earn rewards!

Have you used HOXA9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...