HS3ST5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69629

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HS3ST5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HS3ST5(heparan sulfate (glucosamine) 3-O-sulfotransferase 5) The peptide sequence was selected from the C terminal of HS3ST5. Peptide sequence SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HS3ST5 Antibody - BSA Free

Western Blot: HS3ST5 Antibody [NBP1-69629]

Western Blot: HS3ST5 Antibody [NBP1-69629]

Western Blot: HS3ST5 Antibody [NBP1-69629] - This Anti-HS3ST5 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 0.5ug/ml.

Applications for HS3ST5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HS3ST5

HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.HS3ST5 belongs to a group of heparan sulfate 3-O-sulfotransferases (EC 2.8.2.23) that transfer sulfate from 3-prime-phosphoadenosine 5-prime phosphosulfate (PAPS) to heparan sulfate and heparin (Mochizuki et al., 2003 [PubMed 12740361]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-139 AL355498.10 32491-32629 c 140-2744 AL355498.10 25338-27942 c

Alternate Names

3-OST-5EC 2.8.2.23, 3OST5NBLA04021, EC 2.8.2, h3-OST-5, heparan sulfate (glucosamine) 3-O-sulfotransferase 5, heparan sulfate 3-OST-5, Heparan sulfate 3-O-sulfotransferase 5, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5, heparan sulfate glucosamine 3-O-sulfotransferase 5, HS3OST5

Gene Symbol

HS3ST5

UniProt

Q8IZT8 (Human)

Additional HS3ST5 Products

Product Documents for HS3ST5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HS3ST5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HS3ST5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HS3ST5 Antibody - BSA Free and earn rewards!

Have you used HS3ST5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies