HSBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84079

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HSBP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSBP1. Peptide sequence: AETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HSBP1 Antibody - BSA Free

Western Blot: HSBP1 Antibody [NBP2-84079]

Western Blot: HSBP1 Antibody [NBP2-84079]

Western Blot: HSBP1 Antibody [NBP2-84079] - WB Suggested Anti-HSBP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Western Blot: HSBP1 Antibody [NBP2-84079]

Western Blot: HSBP1 Antibody [NBP2-84079]

Western Blot: HSBP1 Antibody [NBP2-84079] - Host: Rabbit. Target: HSBP1. Positive control (+): Human Brain (BR). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 1ug/ml

Applications for HSBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSBP1

The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation ofHSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor bindingprotein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factorinvolved in the HS response. During HS response, HSF1 undergoes conformational transition from an inertnon-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the activetrimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cellsrepresses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survivalof the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shockresponse. (provided by RefSeq)

Alternate Names

DKFZp686D1664, DKFZp686O24200, heat shock factor binding protein 1, heat shock factor-binding protein 1, HSF1BP, Nasopharyngeal carcinoma-associated antigen 13, NPC-A-13

Gene Symbol

HSBP1

Additional HSBP1 Products

Product Documents for HSBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSBP1 Antibody - BSA Free and earn rewards!

Have you used HSBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies