HSD3B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10203

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B1 (NP_001155214.1). Peptide sequence DIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCAL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HSD3B1 Antibody - BSA Free

Western Blot: HSD3B1 Antibody [NBP3-10203]

Western Blot: HSD3B1 Antibody [NBP3-10203]

Western Blot: HSD3B1 Antibody [NBP3-10203] - Western blot analysis of HSD3B1 in Mouse Brain lysates. Antibody dilution at 1ug/ml

Applications for HSD3B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSD3B1

3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase (HSD3B1) is a bifunctional enzyme involved in the oxidative conversion of steroids and plays an important role in the synthesis of all steroid hormones. There are two HSD3B1 proteins--designated type I and type II--that are expressed by different genes and function in different areas of the body. HSD3B1 has also been shown to be a highly specific and sensitive trophoblast-associated marker.

HSD3B1 is required for the production of progesterone by the placenta, so it is predicted that mutations in this gene may cause infertility in women. HSD3B1 antibodies are useful tools for researchers studying hormone regulation and reproductive biology.

Alternate Names

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G

Gene Symbol

HSD3B1

Additional HSD3B1 Products

Product Documents for HSD3B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSD3B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD3B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD3B1 Antibody - BSA Free and earn rewards!

Have you used HSD3B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...