Hsd3b6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10130

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Hsd3b6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Hsd3b6 (NP_038849.2). Peptide sequence VYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hsd3b6 Antibody - BSA Free

Western Blot: Hsd3b6 Antibody [NBP3-10130]

Western Blot: Hsd3b6 Antibody [NBP3-10130]

Western Blot: Hsd3b6 Antibody [NBP3-10130] - Western blot analysis of Hsd3b6 in Mouse Pancreas lysates. Antibody dilution at 1ug/ml

Applications for Hsd3b6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hsd3b6

3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. May be involved in local production of progesterone. Earliest isoform to be expressed during embryogenesis in cells of embryonic origin at 7 and 9.5 dpc, and is the major isoform expressed in uterine tissue at the time of implantation (4.5 dpc) and continues to be expressed in uterine tissue at 6.5, 7.5 and 9.5 dpc. It is expressed in giant trophoblasts at 9.5 dpc and is expressed in the placenta through 15.5 dpc.

Alternate Names

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6, D19210, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6

Gene Symbol

Hsd3b6

Additional Hsd3b6 Products

Product Documents for Hsd3b6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hsd3b6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hsd3b6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hsd3b6 Antibody - BSA Free and earn rewards!

Have you used Hsd3b6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies