HspA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54348

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HspA4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HSPA4(heat shock 70kDa protein 4) The peptide sequence was selected from the middle region of HSPA4. Peptide sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HspA4 Antibody - BSA Free

Western Blot: HspA4 Antibody [NBP1-54348]

Western Blot: HspA4 Antibody [NBP1-54348]

Western Blot: HspA4 Antibody [NBP1-54348] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: HspA4 Antibody [NBP1-54348]

Western Blot: HspA4 Antibody [NBP1-54348]

Western Blot: HspA4 Antibody [NBP1-54348] - Tissue: Human 721_B.

Applications for HspA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspA4

HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Alternate Names

APG2, APG-2, heat shock 70 kDa protein 4, heat shock 70kD protein 4, heat shock 70kDa protein 4, Heat shock 70-related protein APG-2, heat shock protein, 110 kDa, HS24/P52, hsp70, HSP70RY, MGC131852, RY

Gene Symbol

HSPA4

UniProt

P34932 (Human)

Additional HspA4 Products

Product Documents for HspA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HspA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA4 Antibody - BSA Free and earn rewards!

Have you used HspA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies