ICT Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24906

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ICT Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein ICT using the following amino acid sequence: ITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ICT Antibody - BSA Free

ICT Antibody Western Blot: ICT Antibody [NBP3-24906]

Western Blot: ICT Antibody [NBP3-24906]

Analysis in human cell line RT-4.
ICT Antibody Immunocytochemistry/Immunofluorescence: ICT Antibody [NBP3-24906]

Immunocytochemistry/Immunofluorescence: ICT Antibody [NBP3-24906]

Staining of human cell line U2OS shows localization to mitochondria.

Applications for ICT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ICT

The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.

Alternate Names

Digestion substraction 1, DS-1DS1, EC 3.1.1.29, immature colon carcinoma transcript 1, Immature colon carcinoma transcript 1 protein, peptidyl-tRNA hydrolase ICT1, mitochondrial

Gene Symbol

MRPL58

Additional ICT Products

Product Documents for ICT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ICT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ICT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ICT Antibody - BSA Free and earn rewards!

Have you used ICT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies