IFT122 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54842

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IFT122 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

129 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IFT122 Antibody - BSA Free

Western Blot: IFT122 Antibody [NBP1-54842]

Western Blot: IFT122 Antibody [NBP1-54842]

Western Blot: IFT122 Antibody [NBP1-54842] - IFT122 Antibody Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate
Western Blot: IFT122 Antibody [NBP1-54842]

Western Blot: IFT122 Antibody [NBP1-54842]

Western Blot: IFT122 Antibody [NBP1-54842] - 1. Human 293FT cell line (15ug) 2. Murine IMCD3 cell line (15ug) 3. Human RPE cell line (15ug) 4. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug) 5. Mouse Brain lysate (15ug) Primary Dilution: 1 : 1000 Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1 : 10,000.

Applications for IFT122 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFT122

IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Alternate Names

intraflagellar transport 122 homolog (Chlamydomonas), intraflagellar transport protein 122 homolog, SPGWD repeat-containing protein 140, WD repeat domain 10, WD repeat-containing protein 10, WDR10WDR10p, WDR140CED

Gene Symbol

IFT122

UniProt

Q9HBG6 (Human)

Additional IFT122 Products

Product Documents for IFT122 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IFT122 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IFT122 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFT122 Antibody - BSA Free and earn rewards!

Have you used IFT122 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies