IL-12 R beta 1 Recombinant Protein Antigen

Name: IL-12 R beta 1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-57287PEP
Price: 279 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-57287PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition

View all IL-12 R beta 1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-12 R beta 1.

Source: E. coli

Amino Acid Sequence: TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57287.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-57287PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: IL-12 R beta 1

IL12RB1, also known as Interleukin-12 receptor subunit beta-1, has 3 isoforms, an isoform 1 that is 662 amino acid and 73 kDa, an isoform 2 that is 660 amino acid and 73 kDa, and an isoform3 that is 381 amino acid and 42 kDa; acts as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction; forms a functional, high affinity receptor for IL12 when combined with IL12RB2, and associates also with IL23R to form the interleukin-23 receptor which plays a role in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. Current research is being pursued on this protein involvement in several diseases and disorders including immunodeficiency, mycobacterial and salmonella infections, salmonella gastroenteritis, mycobacterium infectious disease, myocarditis, lupus erythematosus, tuberculosis, sarcoidosis, neurological disorder, rheumatoid arthritis, gastroenteritis, asthma, and dermatitis. IL12RB1 protein involvement has been observed with relation to IL23R, IL23A, IL12A, IL12B, and IL12RB2 in the immune response IL-12 signaling pathway, immune response IL-22 signaling pathway, immune response IL-12-induced IFN-gamma production, cytokine production by Th17 cells in CF, and Jak-STAT signaling pathway.

Long Name

Interleukin 12 Receptor beta 1

Alternate Names

CD212, IL-12Rb1, IL12R beta 1, IL12RB1

Gene Symbol

IL12RB1

Additional IL-12 R beta 1 Products

Product Documents for IL-12 R beta 1 Recombinant Protein Antigen

Download Product Datasheets

Download Antigen Blocking Protocol

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-12 R beta 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.