IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84381PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all IL-28 R alpha/IFN-lambda R1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNLR1.

Source: E. coli

Amino Acid Sequence: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84381.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84381PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-28 R alpha/IFN-lambda R1

IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.

Long Name

Interleukin 28 Receptor alpha

Alternate Names

CRF2-12, IFN-lambda R1, IFNLR1, IL-28Ra, IL28R alpha, IL28RA, LICR2

Gene Symbol

IFNLR1

Additional IL-28 R alpha/IFN-lambda R1 Products

Product Documents for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons

Customer Reviews for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen and earn rewards!

Have you used IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes