IL-3R beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10030

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL-3R beta (NP_000386.1). Peptide sequence HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IL-3R beta Antibody - BSA Free

Western Blot: IL-3R beta Antibody [NBP3-10030]

Western Blot: IL-3R beta Antibody [NBP3-10030]

Western Blot: IL-3R beta Antibody [NBP3-10030] - Western blot analysis of IL-3R beta in Human HepG2 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for IL-3R beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-3R beta

Interleukin 3 (IL-3) is a pleiotropic cytokine that can stimulate proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its activity through binding to a specific cell surface receptor known as IL-3R. IL-3R is a heterodimeric structure composed of a 70 kDa IL-3R alpha subunit (CD123 or beta common) and a 120-140 kDa IL-3R beta subunit (CD131). CD131 also associates with the receptor for Erythropoietin, forming a tissue-protective hetero-receptor complex.

IL-3R alpha binds IL-3 with relatively low affinity. In the presence of IL-3R beta, however, IL-3R alpha has a much higher affinity for IL-3. It is not clear how signal transduction occurs following IL-3 binding. The IL-3R alpha chain has a very short intracellular domain while the IL-3R beta chain has a very large cytoplasmic domain. Recent studies suggest that formation of IL-3R beta-beta homodimers initiates signaling events. The IL-3R beta chain is also shared by the receptors for IL-5 and GM-CSF. Cells known to express IL-3 receptors include hematopoietic progenitors, epithelial cells, double negative T cells, mast cells, basophils and blood monocytes.

Long Name

Interleukin 3 Receptor beta

Alternate Names

IL-3R beta, IL-3Rb, IL3R beta

Gene Symbol

CSF2RB

Additional IL-3R beta Products

Product Documents for IL-3R beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-3R beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-3R beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-3R beta Antibody - BSA Free and earn rewards!

Have you used IL-3R beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...