Importin-9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86679

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Importin-9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Importin-9. Peptide sequence: ARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Importin-9 Antibody - BSA Free

Western Blot: Importin-9 Antibody [NBP2-86679]

Western Blot: Importin-9 Antibody [NBP2-86679]

Western Blot: Importin-9 Antibody [NBP2-86679] - Host: Rabbit. Target Name: IPO9. Sample Tissue: Human Leiomyosarcoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for Importin-9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin-9

Official Gene Symbol: IPO9 Gene ID: 55705 (Human) Gene Map Locus: 1q32.1 (Human) Importin 9 is a novel member of highly conserved Karyopherin Super family. Karyopherins are transport receptors consisting of an N-terminal RanGTP-binding motif and mediate the transport of protein and RNA across the nucleus and cytoplasm. These proteins interact directly with nuclear pore complex and shuttle continuously between the nucleus and cytoplasm. Importin-9 is a RAN-GTP binding protein and mediates the nuclear import of individual core histones and TBP. Reports suggest Importin-9 also interacts with subunits of PP2A (protein phosphatase 2A) and aids in nuclear import.

Alternate Names

DKFZp761M1547, FLJ10402, Imp9IMP9, importin 9, importin-9, KIAA1192, Ran-binding protein 9, ranBP9

Gene Symbol

IPO9

Additional Importin-9 Products

Product Documents for Importin-9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin-9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin-9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin-9 Antibody - BSA Free and earn rewards!

Have you used Importin-9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies