Integrin alpha 9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10039

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Integrin alpha 9 (NP_002198.2). Peptide sequence ISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Integrin alpha 9 Antibody - BSA Free

Western Blot: Integrin alpha 9 Antibody [NBP3-10039]

Western Blot: Integrin alpha 9 Antibody [NBP3-10039]

Western Blot: Integrin alpha 9 Antibody [NBP3-10039] - Western blot analysis of Integrin alpha 9 in Human Neurofibroma Tumor lysates. Antibody dilution at 1ug/ml

Applications for Integrin alpha 9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Integrin alpha 9

Integrin alpha-9 is a protein that functions as a receptor for VCAM1, osteopontin and cytotactin, is located in the airway epithelium, smooth muscle, hepatocytes, and skeletal muscle and is encoded by a gene comprised of 1035 amino acids and weighs approximately 114 kDa. Studies are being conducted on several diseases and disorders related to this protein, including lung cancer, Lynch syndrome, hypertension, PANDAS, medulloblastoma, carcinoma, nasopharyngitis, colorectal cancer, breast cancer, arthritis, and melanoma. Integrin alpha-9 has also been shown to have interactions with FIGF, ITGB7, SAT1, SPP1, and ITGB1 in pathways such as the CDK5, Tec kinases signaling, integrin-mediated cell adhesion, signal transduction, and hypertrophic cardiomyopathy pathways.

Alternate Names

ITGA4L, ITGA9, RLC-alpha

Gene Symbol

ITGA9

Additional Integrin alpha 9 Products

Product Documents for Integrin alpha 9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin alpha 9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin alpha 9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Integrin alpha 9 Antibody - BSA Free and earn rewards!

Have you used Integrin alpha 9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...