Integrin beta 8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59269

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Integrin beta 8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ITGB8(integrin, beta 8) The peptide sequence was selected from the C terminal of ITGB8. Peptide sequence CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Integrin beta 8 Antibody - BSA Free

Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Human Kidney Antibody Dilution: 1.0 ug/ml.
Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269]

Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Reccomended Titration: 1 ug/mL Sample Type: Human Raji

Applications for Integrin beta 8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Integrin beta 8

ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Alternate Names

ITGB8

Gene Symbol

ITGB8

UniProt

P26012

Additional Integrin beta 8 Products

Product Documents for Integrin beta 8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Integrin beta 8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin beta 8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Integrin beta 8 Antibody - BSA Free and earn rewards!

Have you used Integrin beta 8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies