JTB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-04953

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1). EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for JTB Antibody - BSA Free

Western Blot: JTB AntibodyBSA Free [NBP3-04953]

Western Blot: JTB AntibodyBSA Free [NBP3-04953]

Western Blot: JTB Antibody [NBP3-04953] - Analysis of extracts of various cell lines, using JTB antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit

Applications for JTB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: JTB

JTB, also known as Protein JTB, has a 146 amino acid long isoform that is 16 kDa and a short 117 amino acid that is 13 kDa; needed for normal cytokinesis during mitosis, participates in the regulation of cell proliferation, may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly, fosters AURKB activity, its overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential. Disease research is currently being studied with relation to JTB and lymph node tuberculosis, tuberculous meningitis, abdominal tuberculosis, prostatitis, hepatocellular carcinoma, carcinoma, and adenoid cystic carcinoma. The protein has been shown to interact with AURKA, AURKB, BIRC5, INCENP, and LIG3 proteins in apoptotic process, regulation of cell proliferation, cell cycle cytokinesis, mitosis, and cell cycle pathways.

Long Name

Jumping Translocation Breakpoint

Alternate Names

Gm622, HSPC222, PAR Protein

Gene Symbol

JTB

Additional JTB Products

Product Documents for JTB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for JTB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JTB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review JTB Antibody - BSA Free and earn rewards!

Have you used JTB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...