KF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09986

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KF1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KF1 (NP_001185880.1). Peptide sequence HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KF1 Antibody - BSA Free

Western Blot: KF1 Antibody [NBP3-09986]

Western Blot: KF1 Antibody [NBP3-09986]

Western Blot: KF1 Antibody [NBP3-09986] - Western blot analysis of KF1 in Breast Tumor lysates. Antibody dilution at 1ug/ml

Applications for KF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KF1

KF1 is encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants.

Alternate Names

E3 ubiquitin-protein ligase RNF103, EC 6.3.2.-, hKF-1, KF-1, KF1ZFP103ZFP-103, MGC102815, ring finger protein 103MGC41857, Zfp-103, Zinc finger protein 103 homolog, zinc finger protein 103 homolog (mouse), zinc finger protein expressed in cerebellum

Gene Symbol

RNF103

Additional KF1 Products

Product Documents for KF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KF1 Antibody - BSA Free and earn rewards!

Have you used KF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies