Kir3.3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83111

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kir3.3. Peptide sequence: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kir3.3 Antibody - BSA Free

Western Blot: Kir3.3 Antibody [NBP2-83111]

Western Blot: Kir3.3 Antibody [NBP2-83111]

Western Blot: Kir3.3 Antibody [NBP2-83111] - WB Suggested Anti-KCNJ9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: NCI-H226 cell lysateKCNJ9 is supported by BioGPS gene expression data to be expressed in NCIH226

Applications for Kir3.3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kir3.3

The Kir3.3 (KCNJ9) encodes for a 393 amino acid long, 44 kDA, G-protein activated inward rectifier potassium channel protein that creates heteromultimeric pore-forming complexes. The Kir3.3 gene has been investigated in generalized epilepsy, meniere's disease, pertussis, lung cancer, schizophrenia, and diabetes mellitus. It interacts with the DRD4, KCNJ6, ADRB2, KCNJ3, and DRD2 genes in potassium transporting pathways (inward and outward), G-Beta gamma signaling, neurotransmitter receptor binding and downward transmission in the postsynaptic cell, and ion currents in synaptic transmission.

Alternate Names

G protein-activated inward rectifier potassium channel 3, G protein-coupled inward rectifier potassium channel, GIRK-3, GIRK3KIR3.3, Inward rectifier K(+) channel Kir3.3, inwardly rectifier K+ channel KIR3.3, Kir3.3, Potassium channel, inwardly rectifying subfamily J member 9, potassium inwardly-rectifying channel, subfamily J, member 9

Gene Symbol

KCNJ9

Additional Kir3.3 Products

Product Documents for Kir3.3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kir3.3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kir3.3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kir3.3 Antibody - BSA Free and earn rewards!

Have you used Kir3.3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...