KMT2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82270

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KMT2B. Peptide sequence: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KMT2B Antibody - BSA Free

Western Blot: KMT2B Antibody [NBP2-82270]

Western Blot: KMT2B Antibody [NBP2-82270]

Western Blot: KMT2B Antibody [NBP2-82270] - WB Suggested Anti-MLL4 Antibody Titration: 5ug/ml. Positive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Western Blot: KMT2B Antibody [NBP2-82270]

Western Blot: KMT2B Antibody [NBP2-82270]

Western Blot: KMT2B Antibody [NBP2-82270] - Host: Rabbit. Target Name: MLL4. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for KMT2B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KMT2B

MLL4 encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known.

Alternate Names

EC 2.1.1.43, histone-lysine N-methyltransferase MLL4, HRX2, KIAA0304WW domain-binding protein 7, Lysine N-methyltransferase 2D, mixed lineage leukemia gene homolog 2, MLL2, myeloid/lymphoid or mixed-lineage leukemia 4, Myeloid/lymphoid or mixed-lineage leukemia protein 4, Trithorax homolog 2, trithorax homologue 2, TRX2, WBP7, WBP-7, WW domain binding protein 7

Gene Symbol

KMT2B

Additional KMT2B Products

Product Documents for KMT2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KMT2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KMT2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KMT2B Antibody - BSA Free and earn rewards!

Have you used KMT2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...