Kv4.3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87707

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kv4.3. Peptide sequence: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kv4.3 Antibody - BSA Free

Western Blot: Kv4.3 Antibody [NBP2-87707]

Western Blot: Kv4.3 Antibody [NBP2-87707]

Western Blot: Kv4.3 Antibody [NBP2-87707] - WB Suggested Anti-KCND3 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate
Western Blot: Kv4.3 Antibody [NBP2-87707]

Western Blot: Kv4.3 Antibody [NBP2-87707]

Western Blot: Kv4.3 Antibody [NBP2-87707] - Host: Rat. Target Name: KCND3. Sample Tissue: Rat Liver. Antibody Dilution: 1ug/ml

Applications for Kv4.3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv4.3

Potassium channels contribute to maintaining cell volume, membrane potential, neuronal excitability and the secretion of transmitters, salt and hormones. Two families of potassium channels have been identified. One family includes the inwardly rectifying potassium channels whereas, the other family includes: voltage gating (Kv); big conductance, calcium activated (BKca); and small conductance, calcium activated (SK) potassium channels. Voltage gated potassium (Kv) channels represent the most complex class of voltage gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence related potassium channel genes (shaker, shaw, shab, and shal) have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage gated, shal related subfamily, members of which form voltage activated A type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.

Long Name

Potassium voltage-gated channel subfamily D member 3

Alternate Names

KCND3

Gene Symbol

KCND3

Additional Kv4.3 Products

Product Documents for Kv4.3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv4.3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv4.3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv4.3 Antibody - BSA Free and earn rewards!

Have you used Kv4.3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...