KvBeta2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80097

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KvBeta2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KvBeta2 Antibody - BSA Free

Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097] - Host: Mouse. Target Name: KCNAB2. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097] - HepG2 cell lysate, concentration 1.25ug/ml.
Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097]

Western Blot: KvBeta2 Antibody [NBP1-80097] - Antibody Titration: 1 ug/ml Human HepG2.

Applications for KvBeta2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KvBeta2

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. (provided by RefSeq)

Alternate Names

HKvbeta2, HKvbeta2.1, HKvbeta2.2, K(+) channel subunit beta-2, K+ channel beta-2 subunit, KCNA2BAKR6A5, KCNK2, Kv-beta-2, MGC117289, potassium channel shaker chain beta 2, potassium voltage-gated channel, shaker-related subfamily, beta member 2, voltage-gated potassium channel subunit beta-2

Gene Symbol

KCNAB2

UniProt

NP_742128 (Human)

Additional KvBeta2 Products

Product Documents for KvBeta2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KvBeta2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KvBeta2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KvBeta2 Antibody - BSA Free and earn rewards!

Have you used KvBeta2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies