LAPTM4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59964

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LAPTM4A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LAPTM4A(lysosomal-associated protein transmembrane 4 alpha) The peptide sequence was selected from the middle region of LAPTM4A (NP_055528). Peptide sequence VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LAPTM4A Antibody - BSA Free

Western Blot: LAPTM4A Antibody [NBP1-59964]

Western Blot: LAPTM4A Antibody [NBP1-59964]

Western Blot: LAPTM4A Antibody [NBP1-59964] - HepG2 cell lysate, concentration 5.0ug/ml.

Applications for LAPTM4A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LAPTM4A

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Alternate Names

Golgi 4-transmembrane-spanning transporter MTP, HUMORF13, KIAA0108MBNT, LAPTM4lysosomal-associated transmembrane protein 4A, lysosomal protein transmembrane 4 alpha, lysosomal-associated protein transmembrane 4 alpha, membrane nucleoside transporter, Mtrp

Entrez Gene IDs

9741 (Human)

Gene Symbol

LAPTM4A

UniProt

Q15012 (Human)

Additional LAPTM4A Products

Product Documents for LAPTM4A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LAPTM4A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LAPTM4A Antibody - BSA Free

Customer Reviews for LAPTM4A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LAPTM4A Antibody - BSA Free and earn rewards!

Have you used LAPTM4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies