LC3C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57604

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LC3C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit LC3C Antibody - BSA Free (NBP2-57604) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for LC3C Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LC3C Antibody [NBP2-57604]

Immunocytochemistry/ Immunofluorescence: LC3C Antibody [NBP2-57604]

Immunocytochemistry/Immunofluorescence: LC3C Antibody [NBP2-57604] - Staining of human cell line RH-30 shows localization to cytoplasmic bodies. Antibody staining is shown in green.

Applications for LC3C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LC3C

FUNCTION: Probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBUNIT: 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins. SUBCELLULAR LOCATION: LC3-I: Cytoplasm. LC3-II: Intracytoplasmic membrane; lipid-anchor. LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in placenta, lung and ovary. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family.

Long Name

Microtubule-associated Protein 1 Light Chain 3 gamma

Alternate Names

Apg8c, ATG8J, MAP1LC3C

Gene Symbol

MAP1LC3C

Additional LC3C Products

Product Documents for LC3C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LC3C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LC3C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LC3C Antibody - BSA Free and earn rewards!

Have you used LC3C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies