Lefty proteins are novel TGF-beta ligands that function as antagonists of Nodal signaling. The expression of Lefty proteins on the left side of the developing mouse embryo earned this protein family its name. Two genes exist in mouse (Lefty-1 and Lefty-2) and two in humans (Lefty-A and Lefty-B). By amino acid sequence, human Lefty-A and Lefty-B are more similar to each other (96%) than to either Lefty-1 or Lefty-2 in the mouse (81-82%). The Leftys contains some of the features of the cysteine-knot structure conserved among TGF-beta-related proteins, but also some structural differences. Specifically, they lack the alpha-helical segment important for ligand dimerization as well as the cysteine residue involved in stabilization of dimers.
Lefty-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-86700
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Lefty-2. Peptide sequence: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for Lefty-2 Antibody - BSA Free
Western Blot: Lefty-2 Antibody [NBP2-86700]
Western Blot: Lefty-2 Antibody [NBP2-86700] - Host: Rabbit. Target Name: LEFTY2. Sample Type: Thymus Tumor lysates. Antibody Dilution: 1.0ug/mlApplications for Lefty-2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Lefty-2
Alternate Names
Ebaf, TGF-beta 4, TGFB4
Gene Symbol
LEFTY2
Additional Lefty-2 Products
Product Documents for Lefty-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Lefty-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Lefty-2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Lefty-2 Antibody - BSA Free and earn rewards!
Have you used Lefty-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...