LEPROTL1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-83143
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Peptide sequence: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for LEPROTL1 Antibody - BSA Free
Western Blot: LEPROTL1 Antibody [NBP2-83143]
Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human HepG2. Antibody Dilution: 1.0ug/mlLEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cellsWestern Blot: LEPROTL1 Antibody [NBP2-83143]
Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/mlWestern Blot: LEPROTL1 Antibody [NBP2-83143]
Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLaWestern Blot: LEPROTL1 Antibody [NBP2-83143]
Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_BApplications for LEPROTL1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LEPROTL1
Alternate Names
HSPC112, LEPROTL1 leptin receptor overlapping transcript-like 1, my047, Vps55
Gene Symbol
LEPROTL1
Additional LEPROTL1 Products
Product Documents for LEPROTL1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LEPROTL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for LEPROTL1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LEPROTL1 Antibody - BSA Free and earn rewards!
Have you used LEPROTL1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...