LEPROTL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83143

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Peptide sequence: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LEPROTL1 Antibody - BSA Free

Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human HepG2. Antibody Dilution: 1.0ug/mlLEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143]

Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for LEPROTL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LEPROTL1

Alternate Names

HSPC112, LEPROTL1 leptin receptor overlapping transcript-like 1, my047, Vps55

Gene Symbol

LEPROTL1

Additional LEPROTL1 Products

Product Documents for LEPROTL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LEPROTL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LEPROTL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LEPROTL1 Antibody - BSA Free and earn rewards!

Have you used LEPROTL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...