LMO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82275

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LMO1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Lmo1. Peptide sequence: NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGHLNGTFESQVQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LMO1 Antibody - BSA Free

Western Blot: LMO1 Antibody [NBP2-82275]

Western Blot: LMO1 Antibody [NBP2-82275]

Western Blot: LMO1 Antibody [NBP2-82275] - WB Suggested Anti-Lmo1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Testis

Applications for LMO1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMO1

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted.

Alternate Names

Cysteine-rich protein TTG-1, LIM domain only 1 (rhombotin 1), LMO-1, RBTN1MGC116692, RHOM1LIM domain only protein 1, rhombotin-1, TTG1T-cell translocation protein 1

Gene Symbol

LMO1

Additional LMO1 Products

Product Documents for LMO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LMO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMO1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMO1 Antibody - BSA Free and earn rewards!

Have you used LMO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies