LNX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87734

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LNX2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LNX2. Peptide sequence: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LNX2 Antibody - BSA Free

Western Blot: LNX2 Antibody [NBP2-87734]

Western Blot: LNX2 Antibody [NBP2-87734]

Western Blot: LNX2 Antibody [NBP2-87734] - Host: Rabbit. Target Name: LNX2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for LNX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LNX2

LNX2, also known as Ligand of Numb protein X 2, is a 76 kDa, 690 amino acid protein that is involved in interacting with phosphotyrosine as a component of NUMB. Diseases and disorders such as endocarditis and Q fever are being researched with this disease. The protein interacts with UBE21, NUMB, CD8A, LNX1, and E4F1 proteins.

Alternate Names

FLJ23932, FLJ38000, ligand of Numb protein X 2, ligand of numb-protein X 2, MGC46315, Numb-binding protein 2, PDZ domain containing ring finger 1, PDZ domain-containing RING finger protein 1, PDZRN1FLJ12933

Gene Symbol

LNX2

Additional LNX2 Products

Product Documents for LNX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LNX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LNX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LNX2 Antibody - BSA Free and earn rewards!

Have you used LNX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies