LRCH4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69265

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LRCH4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LRCH4(leucine-rich repeats and calponin homology (CH) domain containing 4) The peptide sequence was selected from the middle region of LRCH4. Peptide sequence PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LRCH4 Antibody - BSA Free

Western Blot: LRCH4 Antibody [NBP1-69265]

Western Blot: LRCH4 Antibody [NBP1-69265]

Western Blot: LRCH4 Antibody [NBP1-69265] - This Anti-LRCH4 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.

Applications for LRCH4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LRCH4

LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.

Alternate Names

FLJ40101, FLJ46315, leucine rich repeat neuronal 4, Leucine-rich neuronal protein, leucine-rich repeat and calponin homology domain-containing protein 4, Leucine-rich repeat neuronal protein 4, leucine-rich repeats and calponin homology (CH) domain containing 4, LRN, LRRN1, LRRN4, PP14183

Gene Symbol

LRCH4

UniProt

O75427 (Human)

Additional LRCH4 Products

Product Documents for LRCH4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LRCH4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LRCH4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LRCH4 Antibody - BSA Free and earn rewards!

Have you used LRCH4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies