LRRTM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82276

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LRRTM3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRTM3. Peptide sequence: SLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit LRRTM3 Antibody - BSA Free (NBP2-82276) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for LRRTM3 Antibody - BSA Free

Western Blot: LRRTM3 Antibody [NBP2-82276]

Western Blot: LRRTM3 Antibody [NBP2-82276]

Western Blot: LRRTM3 Antibody [NBP2-82276] - WB Suggested Anti-LRRTM3 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for LRRTM3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LRRTM3

LRRTM3 may play a role in the development and maintenance of the vertebrate nervous system

Long Name

Leucine Rich Repeat Transmembrane Neuronal 3

Alternate Names

leucine rich repeat transmembrane neuronal 3, leucine-rich repeat transmembrane neuronal protein 3, MGC131810

Gene Symbol

LRRTM3

Additional LRRTM3 Products

Product Documents for LRRTM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LRRTM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Activin Family

Customer Reviews for LRRTM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LRRTM3 Antibody - BSA Free and earn rewards!

Have you used LRRTM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies