MafB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87769

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MafB. Peptide Sequence LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MafB Antibody - BSA Free

Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769] - Host: Rabbit. Target Name: MAFB. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769] - WB Suggested Anti-MAFB Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769] - Host: Rabbit. Target Name: MAFB. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769]

Western Blot: MafB Antibody [NBP2-87769] - Host: Mouse. Target Name: MAFB. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for MafB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MafB

MAFB is encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog B

Alternate Names

KRML

Gene Symbol

MAFB

Additional MafB Products

Product Documents for MafB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MafB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MafB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MafB Antibody - BSA Free and earn rewards!

Have you used MafB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...