MafG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82278

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mafg. Peptide sequence: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MafG Antibody - BSA Free

Western Blot: MafG Antibody [NBP2-82278]

Western Blot: MafG Antibody [NBP2-82278]

Western Blot: MafG Antibody [NBP2-82278] - WB Suggested Anti-Mafg Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Muscle

Applications for MafG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MafG

Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+)

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog G

Alternate Names

basic leucine zipper transcription factor MafG, hMAF, MGC13090, MGC20149, transcription factor MafG, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G, V-maf musculoaponeurotic fibrosarcoma oncogene homolog G, v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)

Gene Symbol

MAFG

Additional MafG Products

Product Documents for MafG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MafG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MafG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MafG Antibody - BSA Free and earn rewards!

Have you used MafG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...