MAGEA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57674

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAGEA10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MAGEA10(melanoma antigen family A, 10) The peptide sequence was selected from the middle region of MAGEA10. Peptide sequence GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MAGEA10 Antibody - BSA Free

Western Blot: MAGEA10 Antibody [NBP1-57674]

Western Blot: MAGEA10 Antibody [NBP1-57674]

Western Blot: MAGEA10 Antibody [NBP1-57674] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for MAGEA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAGEA10

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene.

Alternate Names

Cancer/testis antigen 1.10, CT1.10member 10, MAGE-10 antigen, melanoma antigen family A, 10, melanoma-associated antigen 10

Gene Symbol

MAGEA10

UniProt

P43363 (Human)

Additional MAGEA10 Products

Product Documents for MAGEA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAGEA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAGEA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAGEA10 Antibody - BSA Free and earn rewards!

Have you used MAGEA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies