MAPK1IP1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83183

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MAPK1IP1L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAPK1IP1L. Peptide sequence: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MAPK1IP1L Antibody - BSA Free

Western Blot: MAPK1IP1L Antibody [NBP2-83183]

Western Blot: MAPK1IP1L Antibody [NBP2-83183]

Western Blot: MAPK1IP1L Antibody [NBP2-83183] - Host: Rabbit. Target Name: MAPK1IP1L. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/mlMAPK1IP1L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Applications for MAPK1IP1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAPK1IP1L

Alternate Names

c14_5346, C14orf32, chromosome 14 open reading frame 32, MAPK-interacting and spindle-stabilizing protein, MAPK-interacting and spindle-stabilizing protein-like, MGC23138, MISS, mitogen activated protein kinase 1 interacting protein 1-like, mitogen-activated protein kinase 1 interacting protein 1-like, Mitogen-activated protein kinase 1-interacting protein 1-like

Gene Symbol

MAPK1IP1L

Additional MAPK1IP1L Products

Product Documents for MAPK1IP1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAPK1IP1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAPK1IP1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAPK1IP1L Antibody - BSA Free and earn rewards!

Have you used MAPK1IP1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies