Margatoxin

Catalog # Availability Size / Price Qty
3563/100U
Margatoxin
1 Image
Description: Potent KV1.3 channel blocker
Alternative Names: MgTX
Product Details
Reviews (1)

Biological Activity

Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data

M.Wt:
4178.96
Formula:
C178H286N52O50S7
Sequence:
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)

Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Store at -20°C
CAS No:
145808-47-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Margatoxin

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Margatoxin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Great water soluble selective Kv channel blocker
By Anonymous on 10/15/2018
Species: Human

Margatoxin was used in our lab to study SK channel opening and blocking effect. Margatoxin was used to compare with other selective SK channel blockers as they do not show significant SK blocking. The product performed excellent in sterile cell culture labs and would high recommend. The product is water soluble which is also a plus.


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.