MAT1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54893

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAT1A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I, alpha) The peptide sequence was selected from the C terminal of MAT1A. Peptide sequence VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MAT1A Antibody - BSA Free

Western Blot: MAT1A Antibody [NBP1-54893]

Western Blot: MAT1A Antibody [NBP1-54893]

Western Blot: MAT1A Antibody [NBP1-54893] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: MAT1A Antibody [NBP1-54893]

Western Blot: MAT1A Antibody [NBP1-54893]

Western Blot: MAT1A Antibody [NBP1-54893] - Reccomended Titration: 2.5 ug/ml Positive Control: Human Liver

Applications for MAT1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAT1A

MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Alternate Names

AdoMet synthase 1, adoMet synthetase 1, AMS1, MAT, MATA1MAT 1, MAT-I/III, Methionine adenosyltransferase 1, methionine adenosyltransferase I, alpha, Methionine adenosyltransferase I/III, S-adenosylmethionine synthase isoform type-1, S-adenosylmethionine synthetase isoform type-1, SAMS, SAMS1EC 2.5.1.6

Gene Symbol

MAT1A

UniProt

Q00266 (Human)

Additional MAT1A Products

Product Documents for MAT1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAT1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAT1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAT1A Antibody - BSA Free and earn rewards!

Have you used MAT1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies