MCM6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58075

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCM6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MCM6(minichromosome maintenance complex component 6) The peptide sequence was selected from the C terminal of MCM6. Peptide sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCM6 Antibody - BSA Free

Western Blot: MCM6 Antibody [NBP1-58075]

Western Blot: MCM6 Antibody [NBP1-58075]

Western Blot: MCM6 Antibody [NBP1-58075] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075] - Human thymus.
Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for MCM6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM6

The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Alternate Names

DNA replication licensing factor MCM6, EC 3.6.4.12, MCG40308, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae), minichromosome maintenance complex component 6, minichromosome maintenance deficient (mis5, S. pombe) 6, minichromosome maintenance deficient 6 homolog, minichromosome maintenance deficient 6 homolog (S. cerevisiae), Mis5, MIS5 homolog, p105MCM

Gene Symbol

MCM6

UniProt

Q14566 (Mouse)

Additional MCM6 Products

Product Documents for MCM6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCM6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM6 Antibody - BSA Free and earn rewards!

Have you used MCM6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies