MCM8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58130

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MCM8 (minichromosome maintenance complex component 8) The peptide sequence was selected from the N terminal of MCM8. Peptide sequence ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCM8 Antibody - BSA Free

Western Blot: MCM8 Antibody [NBP1-58130]

Western Blot: MCM8 Antibody [NBP1-58130]

Western Blot: MCM8 Antibody [NBP1-58130] - Jurkat cell lysate, concentration 0.125ug/ml.

Applications for MCM8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM8

MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Alternate Names

C20orf154, chromosome 20 open reading frame 154, dJ967N21.5, DNA replication licensing factor MCM8, MCM8 minichromosome maintenance deficient 8, MGC119522, MGC119523, MGC12866, MGC4816, Minichromosome maintenance 8, minichromosome maintenance complex component 8, REC, REC homolog

Gene Symbol

MCM8

UniProt

Additional MCM8 Products

Product Documents for MCM8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM8 Antibody - BSA Free and earn rewards!

Have you used MCM8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...