MCM9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58128

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCM9 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of human MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCM9 Antibody - BSA Free

Western Blot: MCM9 Antibody [NBP1-58128]

Western Blot: MCM9 Antibody [NBP1-58128]

Western Blot: MCM9 Antibody [NBP1-58128] - Antibody Titration: 1 ug/ml Human liver.
Western Blot: MCM9 Antibody [NBP1-58128]

Western Blot: MCM9 Antibody [NBP1-58128]

Western Blot: MCM9 Antibody [NBP1-58128] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for MCM9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM9

MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Alternate Names

C6orf61, chromosome 6 open reading frame 61, dJ329L24.1, dJ329L24.3, DNA replication licensing factor MCM9, FLJ13942, FLJ20170, FLJ56845, hMCM9, MCMDC1, MGC35304, minichromosome maintenance complex component 9, Mini-chromosome maintenance deficient 9, minichromosome maintenance deficient domain containing 1, Mini-chromosome maintenance deficient domain-containing protein 1

Entrez Gene IDs

254394 (Human)

Gene Symbol

MCM9

UniProt

B3KV41 (Human)

Additional MCM9 Products

Product Documents for MCM9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCM9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM9 Antibody - BSA Free and earn rewards!

Have you used MCM9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies