MDGA2 (MAM domain-containing glycosylphosphatidylinositol anchor protein 2; also named MAMDC1) is a 130 kDa member of the Ig superfamily of proteins. Human MDGA2 is synthesized as a 956 amino acid (aa) precursor that contains a 25 aa signal sequence, a 906 aa mature chain, and a 25 aa propeptide. The mature chain consists of six Ig-like domains, followed by a MAM domain (aa 746-921) and a GPI anchor. In addition, there are eight potential sites for N-linked glycosylation. Mature human MDGA2 shares 98% aa sequence identity with mature mouse and rat MDGA2. MDGA2 is structurally similar to other IgCAMS, such as the L1 family and axonin 1, which have roles in cell adhesion, migration, and process outgrowth. Northern blot analysis shows MDGA2 expression is limited to the central and peripheral nervous system. Within the brain, moderate expression is observed in the cerebral cortex, the hindbrain, the basilar pons, the neocortex, the hippocampus, the amygdala, olfactory bulb, and selected nuclei of the thalamus. The similarity of MDGA2 to other Ig-containing molecules, and its temporal-spatial patterns of expression within restricted neuronal populations, suggest a role for MDGA2 in regulating neuronal migration, as well as other aspects of neural development, including axon guidance. One study shows that MDGA2 gene is implicated in neuroticism.
MDGA2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-09496
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MDGA2 (NP_878250). Peptide sequence TATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSI
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for MDGA2 Antibody - BSA Free
Western Blot: MDGA2 Antibody [NBP3-09496]
Western Blot: MDGA2 Antibody [NBP3-09496] - Western blot analysis of MDGA2 in Jurkat Whole Cell as a positive control. Antibody dilution at 1.0 ug/mlApplications for MDGA2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MDGA2
Long Name
MAM Domain Containing Glycosylphosphatidylinositol Anchor 2
Alternate Names
MAMDC1
Gene Symbol
MDGA2
Additional MDGA2 Products
Product Documents for MDGA2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MDGA2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for MDGA2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MDGA2 Antibody - BSA Free and earn rewards!
Have you used MDGA2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...