MDGA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09496

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MDGA2 (NP_878250). Peptide sequence TATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSI

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MDGA2 Antibody - BSA Free

Western Blot: MDGA2 Antibody [NBP3-09496]

Western Blot: MDGA2 Antibody [NBP3-09496]

Western Blot: MDGA2 Antibody [NBP3-09496] - Western blot analysis of MDGA2 in Jurkat Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for MDGA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MDGA2

MDGA2 (MAM domain-containing glycosylphosphatidylinositol anchor protein 2; also named MAMDC1) is a 130 kDa member of the Ig superfamily of proteins. Human MDGA2 is synthesized as a 956 amino acid (aa) precursor that contains a 25 aa signal sequence, a 906 aa mature chain, and a 25 aa propeptide. The mature chain consists of six Ig-like domains, followed by a MAM domain (aa 746-921) and a GPI anchor. In addition, there are eight potential sites for N-linked glycosylation. Mature human MDGA2 shares 98% aa sequence identity with mature mouse and rat MDGA2. MDGA2 is structurally similar to other IgCAMS, such as the L1 family and axonin 1, which have roles in cell adhesion, migration, and process outgrowth. Northern blot analysis shows MDGA2 expression is limited to the central and peripheral nervous system. Within the brain, moderate expression is observed in the cerebral cortex, the hindbrain, the basilar pons, the neocortex, the hippocampus, the amygdala, olfactory bulb, and selected nuclei of the thalamus. The similarity of MDGA2 to other Ig-containing molecules, and its temporal-spatial patterns of expression within restricted neuronal populations, suggest a role for MDGA2 in regulating neuronal migration, as well as other aspects of neural development, including axon guidance. One study shows that MDGA2 gene is implicated in neuroticism.

Long Name

MAM Domain Containing Glycosylphosphatidylinositol Anchor 2

Alternate Names

MAMDC1

Gene Symbol

MDGA2

Additional MDGA2 Products

Product Documents for MDGA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MDGA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MDGA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MDGA2 Antibody - BSA Free and earn rewards!

Have you used MDGA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...