ME2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54765

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ME2(malic enzyme 2, NAD(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME2. Peptide sequence MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ME2 Antibody - BSA Free

Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765]

Western Blot: ME2 Antibody [NBP1-54765] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for ME2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ME2

ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.This gene encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

EC 1.1.1, EC 1.1.1.38, malate dehydrogenase, Malic enzyme 2, malic enzyme 2, NAD(+)-dependent, mitochondrial, NAD-dependent malic enzyme, mitochondrial, NAD-ME, ODS1, pyruvic-malic carboxylase

Gene Symbol

ME2

UniProt

Additional ME2 Products

Product Documents for ME2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ME2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ME2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ME2 Antibody - BSA Free and earn rewards!

Have you used ME2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...