MED28 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85104

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MED28 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MED28 Antibody - BSA Free

Western Blot: MED28 Antibody [NBP1-85104]

Western Blot: MED28 Antibody [NBP1-85104]

Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104]

Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104]

Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104] - Staining of human placenta shows nuclear positivity in trophoblastic cells.
Western Blot: MED28 Antibody [NBP1-85104]

Western Blot: MED28 Antibody [NBP1-85104]

Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Applications for MED28 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED28

MED28 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatoryproteins to the basal RNA polymerase

Alternate Names

DKFZP434N185, EG1DKFZp434N185, Magicin, mediator complex subunit 281500003D12Rik, mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae), subunit 28 homolog

Gene Symbol

MED28

Additional MED28 Products

Product Documents for MED28 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MED28 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED28 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED28 Antibody - BSA Free and earn rewards!

Have you used MED28 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies