MEKK3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-34004PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all MEKK3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP3K3.

Source: E. coli

Amino Acid Sequence: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34004.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-34004PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MEKK3

MEKK3 is a Ser/Thr protein kinase belonging to the MAP/ERK kinase kinase family (1). Closely related to MEKK2, MEKK3 is expressed in a multitude of tissues. MEKK3 directly regulates SAPKs and ERKs pathway via SEK and MEK1, respectively but not the p38 pathway (2) and is also involved in the NF-kB pathway (3). MEKK3 as well as MEKK2 bind, phosphorylate and activate MEK5 through their PB1 domain (4). hKSR-2 (human kinase suppressor of ras-2) has been shown to regulate the activity of MEKK3 (5).

Long Name

Mitogen-activated Protein Kinase Kinase Kinase 3

Alternate Names

MAP3K3, MAPKKK3

Gene Symbol

MAP3K3

Additional MEKK3 Products

Product Documents for MEKK3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MEKK3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases
NFkB Pathway

Customer Reviews for MEKK3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MEKK3 Recombinant Protein Antigen and earn rewards!

Have you used MEKK3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes