MFAP4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-30439PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all MFAP4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFAP4.

Source: E. coli

Amino Acid Sequence: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30439.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-30439PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MFAP4

MFAP4, also known as Microfibril-associated glycoprotein 4, has 2 isoforms, a 255 amino acid short isoform that is 29 kDa and a long 297 amino acid isoforms that is 33 kDa, binding specificities for both collagen and carbohydrate, and it is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The protein is being studied for its involvement in smith-magenis syndrome, intracranial aneurysm, liver cirrhosis, and ovarian cancer. MFAP4 protein involvement has been observed with relation to SFTPD and HDAC1 in molecules associated with elastic fibres, extracellular matrix organization, and elastic fibre formation pathways.

Long Name

Microfibril-associated Glycoprotein 4

Alternate Names

MFAP-4

Gene Symbol

MFAP4

Additional MFAP4 Products

Product Documents for MFAP4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MFAP4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Extracellular Matrix Molecules

Customer Reviews for MFAP4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MFAP4 Recombinant Protein Antigen and earn rewards!

Have you used MFAP4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes