MFNG Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-79288
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot
Cited:
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the middle region of human MFNG (NP_002396). Peptide sequence MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for MFNG Antibody - BSA Free
Western Blot: MFNG Antibody [NBP1-79288]
Western Blot: Manic Fringe Antibody [NBP1-79288] - HepG2 cell lysate, concentration 0.2-1 ug/ml.Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -
miR205-5p reduced the MFNG mRNA level by directly binding to its 3′ UTR region and inhibited the malignancy of TNBC cells. (A) The predicted binding sites of miR205-5p in the 3′-UTR of MFNG were performed using bioinformatics. (B,C) Overexpression of miR205-5p mimic in TNBC cells reduced the mRNA and protein expression levels of MFNG, NC was short for negative control and GAPDH was loaded as an internal control. (D) Ectopic expression of miR205-5p reduced the luciferase activity of wild-type 3′-UTR of MFNG in MDA-MB-231cells. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001, ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -
miR205-5p had potential in TNBC therapy. (A) Picture of miR205-5p-PEI-BP taken by transmission electron microscope, scale bar is 200 nm. (B) The light absorption spectrum of miR205-5p-PEI-BP. (C) The zeta electric potential of miR205-5p-PEI-BP. (D–F) The effect of miR205-5p-PEI-BP on cell growth and metastasis was examined by clone formation, transwell, and wound-healing assays (5 nmol), NC was the negative control of miR205-5p. (G) A time course of tumor growth. The decrease in tumor volume of the mice treated with miR205-5p-PEI-BP compared to their negative controls. Mice were treated with NC-PEI-BP (5 nmol) or miR205-5p-PEI-PB (5 nmol) twice a week for two weeks. (H,I) Following the sacrifice of mice, tumors were removed, photographed, and tumor weight was measured. (J) Western blot and (K) RT-qPCR analysis confirmed that MFNG was downregulated in the tumors treated with miR205-5p-PEI-PB, and GAPDH served as an internal control. (L) A comprehensive summary of the GATA3-miR205-5p feed-forward loop mechanism that targets MFNG and inhibits tumor growth and metastasis in TNBC. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -
MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -
MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: MFNG Antibody - BSA Free [NBP1-79288] -
MFNG expression was significantly increased in TNBC tissues and positively associated with the poor prognosis of TNBC patients. (A) Based on the TCGA data (nature, 2012), we investigated the MFNG expression in TNBC (n = 389) and non-TNBC (n = 90) breast cancer samples. (B) Immunohistochemistry assay was used to assess the MFNG protein level in TNBC (n = 15) and non-TNBC (n = 12) breast cancer tissues (left), and the result of statistical analysis was shown (right). (C) MFNG mRNA expression level was examined in TNBC and non-TNBC cells in RT-qPCR, data representing the mean +/- SD of three replicates. According to the MFNG expression level (Z-score) in breast cancers samples (TCGA, nature, 2012), patients were divided into MFNG low (Z-score ≤ −0.4319) and high (Z-score > −0.4319) expression groups. We analyzed the overall survival of breast cancers (D), non-TNBC (E), and TNBC (F) samples by using the Kaplan–Meier method, breast cancer (MFNG low, n = 358; MFNG high, n = 121; p = 0.5557), non-TNBC (MFNG low, n = 292; MFNG high, n = 99; p = 0.8409), and TNBC (MFNG low, n = 68; MFNG high, n = 23; p < 0.001). Survival curves were plotted by the Kaplan–Meier method and analyzed by the log-rank test. Statistical analyses were analyzed using a Student’s t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: MFNG Antibody - BSA Free [NBP1-79288] -
MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MFNG Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MFNG
Long Name
Manic Fringe O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Alternate Names
beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Entrez Gene IDs
4242 (Human)
Gene Symbol
MFNG
UniProt
Additional MFNG Products
Product Documents for MFNG Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MFNG Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MFNG Antibody - BSA Free
Customer Reviews for MFNG Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MFNG Antibody - BSA Free and earn rewards!
Have you used MFNG Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...