MFNG Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79288

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MFNG Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human MFNG (NP_002396). Peptide sequence MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MFNG Antibody - BSA Free

Western Blot: MFNG Antibody [NBP1-79288]

Western Blot: MFNG Antibody [NBP1-79288]

Western Blot: Manic Fringe Antibody [NBP1-79288] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
MFNG Antibody - BSA Free

Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -

miR205-5p reduced the MFNG mRNA level by directly binding to its 3′ UTR region and inhibited the malignancy of TNBC cells. (A) The predicted binding sites of miR205-5p in the 3′-UTR of MFNG were performed using bioinformatics. (B,C) Overexpression of miR205-5p mimic in TNBC cells reduced the mRNA and protein expression levels of MFNG, NC was short for negative control and GAPDH was loaded as an internal control. (D) Ectopic expression of miR205-5p reduced the luciferase activity of wild-type 3′-UTR of MFNG in MDA-MB-231cells. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001, ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MFNG Antibody - BSA Free

Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -

miR205-5p had potential in TNBC therapy. (A) Picture of miR205-5p-PEI-BP taken by transmission electron microscope, scale bar is 200 nm. (B) The light absorption spectrum of miR205-5p-PEI-BP. (C) The zeta electric potential of miR205-5p-PEI-BP. (D–F) The effect of miR205-5p-PEI-BP on cell growth and metastasis was examined by clone formation, transwell, and wound-healing assays (5 nmol), NC was the negative control of miR205-5p. (G) A time course of tumor growth. The decrease in tumor volume of the mice treated with miR205-5p-PEI-BP compared to their negative controls. Mice were treated with NC-PEI-BP (5 nmol) or miR205-5p-PEI-PB (5 nmol) twice a week for two weeks. (H,I) Following the sacrifice of mice, tumors were removed, photographed, and tumor weight was measured. (J) Western blot and (K) RT-qPCR analysis confirmed that MFNG was downregulated in the tumors treated with miR205-5p-PEI-PB, and GAPDH served as an internal control. (L) A comprehensive summary of the GATA3-miR205-5p feed-forward loop mechanism that targets MFNG and inhibits tumor growth and metastasis in TNBC. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MFNG Antibody - BSA Free

Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -

MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MFNG Antibody - BSA Free

Western Blot: MFNG Antibody - BSA Free [NBP1-79288] -

MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MFNG Antibody - BSA Free

Immunohistochemistry: MFNG Antibody - BSA Free [NBP1-79288] -

MFNG expression was significantly increased in TNBC tissues and positively associated with the poor prognosis of TNBC patients. (A) Based on the TCGA data (nature, 2012), we investigated the MFNG expression in TNBC (n = 389) and non-TNBC (n = 90) breast cancer samples. (B) Immunohistochemistry assay was used to assess the MFNG protein level in TNBC (n = 15) and non-TNBC (n = 12) breast cancer tissues (left), and the result of statistical analysis was shown (right). (C) MFNG mRNA expression level was examined in TNBC and non-TNBC cells in RT-qPCR, data representing the mean +/- SD of three replicates. According to the MFNG expression level (Z-score) in breast cancers samples (TCGA, nature, 2012), patients were divided into MFNG low (Z-score ≤ −0.4319) and high (Z-score > −0.4319) expression groups. We analyzed the overall survival of breast cancers (D), non-TNBC (E), and TNBC (F) samples by using the Kaplan–Meier method, breast cancer (MFNG low, n = 358; MFNG high, n = 121; p = 0.5557), non-TNBC (MFNG low, n = 292; MFNG high, n = 99; p = 0.8409), and TNBC (MFNG low, n = 68; MFNG high, n = 23; p < 0.001). Survival curves were plotted by the Kaplan–Meier method and analyzed by the log-rank test. Statistical analyses were analyzed using a Student’s t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MFNG Antibody - BSA Free

Immunohistochemistry: MFNG Antibody - BSA Free [NBP1-79288] -

MFNG expression enhanced the cell growth and migration of TNBC cells. MFNG overexpression and knockdown were detected by RT-qPCR (A) and Western blot (B) in TNBC cells, SCR was short for Scramble and GAPDH served as an internal control. (C,D) The effect of MFNG on cell growth was examined in TNBC cells by colony formation and CCK8 assays. (E) The cell migration was assessed by transwell in MFNG-overexpressing or knockdown TNBC cells. (F) Western blot analysis of epithelial–mesenchymal transition (EMT) and growth-related genes in TNBC cells overexpressing MFNG, GAPDH was loaded as an internal control. (G) RT-qPCR analyzed the expression of Notch target genes HES1 and HEY1 in TNBC cells overexpressing MFNG, GAPDH served as an internal control. Data were analyzed using a Student’s t-test. All * p < 0.05, ** p < 0.01, *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35804829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MFNG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MFNG

MFNG, also known as Beta-1,3-N-acetylglucosaminyltransferase manic fringe, has 2 isoforms, a 321 amino acid isoform that is 36 kDa and a 307 amino acid isoform that is 35 kDa, Golgi apparatus membrane subcellular location, participates in the elongation of O-linked ligands to activate Notch signaling and has fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity. Studies on this protein have shown a relationship with the following diseases and disorders: alagille syndrome, basal cell carcinoma, hepatitis b, psoriasis, hepatitis, and carcinoma. This protein has also been shown to have interactions with NOTCH2, JAG1, JAG2, DLL1, NOTCH1, ITGA3, LHX2, and NOTCH3 in Notch signaling pathway, Pre-NOTCH Expression and Processing, Pre-NOTCH Processing in Golgi, Signal Transduction, Delta-Notch Signaling Pathway, other types of O-glycan biosynthesis, and Development Notch Signaling Pathway.

Long Name

Manic Fringe O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Alternate Names

beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Entrez Gene IDs

4242 (Human)

Gene Symbol

MFNG

UniProt

O00587 (Human)

Additional MFNG Products

Product Documents for MFNG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MFNG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MFNG Antibody - BSA Free

Customer Reviews for MFNG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MFNG Antibody - BSA Free and earn rewards!

Have you used MFNG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail