MRPL44 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87827

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL44 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL44. Peptide sequence: EGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL44 Antibody - BSA Free

Western Blot: MRPL44 Antibody [NBP2-87827]

Western Blot: MRPL44 Antibody [NBP2-87827]

Western Blot: MRPL44 Antibody [NBP2-87827] - Host: Rabbit. Target Name: MRPL44. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL44 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL44

MRPL44, or Mitochondrial Ribosomal Protein L44, consists of a 332 amino acid isoform that is 38 kDa, and is involved in protein synthesis as a part of the 39S mitochondrial ribosome subunit. Disease research is currently being conducted to determine the relationship between MRPL44 and intrahepatic cholangiocarcinoma. The protein has been linked to RNA processing, and interacts with IMMT, SETDB1, VIM, USP22, and CEP70.

Alternate Names

39S ribosomal protein L44, mitochondrial, EC 3.1.26, EC 3.1.26.-, FLJ12701, FLJ13990, FLJ37688, L44MT, mitochondrial ribosomal protein L44, MRP-L44

Gene Symbol

MRPL44

Additional MRPL44 Products

Product Documents for MRPL44 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL44 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL44 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL44 Antibody - BSA Free and earn rewards!

Have you used MRPL44 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies